HW6

Гомологичное моделирование комплекса белка с лигандом¶

In [16]:
import sys 
import modeller 
import _modeller
import modeller.automodel

import numpy as np


import warnings
warnings.filterwarnings('ignore') # make the notebook nicer
from __future__ import print_function

import pytraj as pt
import nglview as nv

from IPython.display import display, Image
In [2]:
env = modeller.environ()
env.io.hetatm = True
                         MODELLER 9.19, 2017/07/19, r11078

     PROTEIN STRUCTURE MODELLING BY SATISFACTION OF SPATIAL RESTRAINTS


                     Copyright(c) 1989-2017 Andrej Sali
                            All Rights Reserved

                             Written by A. Sali
                               with help from
              B. Webb, M.S. Madhusudhan, M-Y. Shen, G.Q. Dong,
          M.A. Marti-Renom, N. Eswar, F. Alber, M. Topf, B. Oliva,
             A. Fiser, R. Sanchez, B. Yerkovich, A. Badretdinov,
                     F. Melo, J.P. Overington, E. Feyfant
                 University of California, San Francisco, USA
                    Rockefeller University, New York, USA
                      Harvard University, Cambridge, USA
                   Imperial Cancer Research Fund, London, UK
              Birkbeck College, University of London, London, UK


Kind, OS, HostName, Kernel, Processor: 4, Linux shadbox 3.2.0-29-generic x86_64
Date and time of compilation         : 2017/07/19 14:40:43
MODELLER executable type             : x86_64-intel8
Job starting time (YY/MM/DD HH:MM:SS): 2017/12/24 06:02:33

Возьмем лизоцим гориллы (P79179 (LYSC_GORGO)):

In [3]:
%%bash
wget http://www.pdb.org/pdb/files/1lmp.pdb
wget http://www.uniprot.org/uniprot/P79179.fasta
--2017-12-24 06:02:38--  http://www.pdb.org/pdb/files/1lmp.pdb
Resolving www.pdb.org (www.pdb.org)... 128.6.244.52
Connecting to www.pdb.org (www.pdb.org)|128.6.244.52|:80... connected.
HTTP request sent, awaiting response... 301 Moved Permanently
Location: https://www.rcsb.org/pdb/files/1lmp.pdb [following]
--2017-12-24 06:02:39--  https://www.rcsb.org/pdb/files/1lmp.pdb
Resolving www.rcsb.org (www.rcsb.org)... 132.249.213.110
Connecting to www.rcsb.org (www.rcsb.org)|132.249.213.110|:443... connected.
HTTP request sent, awaiting response... 301 Moved Permanently
Location: http://files.rcsb.org/view/1lmp.pdb [following]
--2017-12-24 06:02:40--  http://files.rcsb.org/view/1lmp.pdb
Resolving files.rcsb.org (files.rcsb.org)... 132.249.213.140
Connecting to files.rcsb.org (files.rcsb.org)|132.249.213.140|:80... connected.
HTTP request sent, awaiting response... 200 OK
Length: unspecified [text/plain]
Saving to: `1lmp.pdb'

     0K .......... .......... .......... .......... ..........  108K
    50K .......... .......... .......... .......... ..........  108K
   100K .......... .......... ........                          122K=1.2s

2017-12-24 06:02:42 (110 KB/s) - `1lmp.pdb' saved [131301]

--2017-12-24 06:02:42--  http://www.uniprot.org/uniprot/P79179.fasta
Resolving www.uniprot.org (www.uniprot.org)... 128.175.240.211, 193.62.193.81
Connecting to www.uniprot.org (www.uniprot.org)|128.175.240.211|:80... connected.
HTTP request sent, awaiting response... 200 OK
Length: 228 [text/plain]
Saving to: `P79179.fasta'

     0K                                                       100% 40.1M=0s

2017-12-24 06:02:42 (40.1 MB/s) - `P79179.fasta' saved [228/228]

Создадим объект выравнивание и добавим последовательность и структуру:

In [4]:
alignm = modeller.alignment(env)
alignm.append(file = 'P79179.fasta', align_codes = 'all', alignment_format = 'FASTA')
## создадим модель
mdl = modeller.model(env, file = '1lmp.pdb', model_segment = ('FIRST:'+'A', 'LAST:'+'A'))
## и добавим в выравнивание
alignm.append_model(mdl, atom_files = '1lmp.pdb', align_codes='1lmp')
## есть смысл поправить идентификаторы
alignm[0].code = 'model'
alignm[1].code = 'aligment'
alignm.salign()
alignm.write(file = 'all_in_one.ali', alignment_format = 'PIR')
read_pd_459W> Residue type  NAG not recognized. 'automodel' model building
              will treat this residue as a rigid body.
              To use real parameters, add the residue type to ${LIB}/restyp.lib,
              its topology to ${LIB}/top_*.lib, and suitable forcefield
              parameters to ${LIB}/par.lib.
rdpdb___459W> Residue type  NDG not recognized. 'automodel' model building
              will treat this residue as a rigid body.
              To use real parameters, add the residue type to ${LIB}/restyp.lib,
              its topology to ${LIB}/top_*.lib, and suitable forcefield
              parameters to ${LIB}/par.lib.

SALIGN_____> adding the next group to the alignment; iteration    1
In [5]:
with open('all_in_one.ali') as f:
    print(f.readlines())
['\n', '>P1;model\n', 'sequence::     : :     : :::-1.00:-1.00\n', 'MKALIVLGLVLLSVMVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIF\n', 'QINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV--\n', '-*\n', '\n', '>P1;aligment\n', 'structureX:1lmp.pdb:   1 :A:+132 :A:MOL_ID  1; MOLECULE  LYSOZYME; CHAIN  A; SYNONYM  MUCOPEPTIDE N-ACETYLMURAMYLHYDROLASE; EC  3.2.1.17:MOL_ID  1; ORGANISM_SCIENTIFIC  ONCORHYNCHUS MYKISS; ORGANISM_COMMON  RAINBOW TROUT; ORGANISM_TAXID  8022; ORGAN  KIDNEY: 2.00: 0.16\n', '------------------KVYDRCELARALKASGMDGYAGNSLPNWVCLSKWESSYNTQATNRNT-DGSTDYGIF\n', 'QINSRYWCDDGRTPGAKNVCGIRCSQLLTDDLTVAIRCAKRVVLDPNGIGAWVAWRLHCQNQDLRSYVAGCGV..\n', '.*\n']
In [7]:
## Выбираем объект для моделирования 
s = alignm[0]
pdb = alignm[1]

# print s.code, pdb.code

## Создаем объект automodel
a = modeller.automodel.automodel(env, alnfile = 'all_in_one.ali', knowns = pdb.code, sequence = s.code)

a.name = 'mod' + s.code
a.starting_model = 1
a.ending_model = 1 #2
a.make()
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)

check_ali___> Checking the sequence-structure alignment. 

Implied intrachain target CA(i)-CA(i+1) distances longer than  8.0 angstroms:

ALN_POS  TMPL  RID1  RID2  NAM1  NAM2     DIST
----------------------------------------------
END OF TABLE
read_to_681_> topology.submodel read from topology file:        3
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)
patch_s_522_> Number of disulfides patched in MODEL:        4
mdtrsr__446W> A potential that relies on one protein is used, yet you have at
              least one known structure available. MDT, not library, potential is used.
iup2crm_280W> No topology library in memory or assigning a BLK residue.
              Default CHARMM atom type assigned:  C1 -->  CT2
              This message is written only for the first such atom.
0 atoms in HETATM/BLK residues constrained
to protein atoms within 2.30 angstroms
and protein CA atoms within 10.00 angstroms
0 atoms in residues without defined topology
constrained to be rigid bodies
condens_443_> Restraints marked for deletion were removed.
              Total number of restraints before, now:    13197    12190


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      148
Number of all, selected real atoms                :     1158    1158
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :    12190   12190
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):     2361
Dynamic pairs routine                             : 2, NATM x NATM cell sorting
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        0   99999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :    4.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       T       F       F       F
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :         870.5908





Summary of the restraint violations: 

   NUM     ... number of restraints.
   NUMVI   ... number of restraints with RVIOL > VIOL_REPORT_CUT[i].
   RVIOL   ... relative difference from the best value.
   NUMVP   ... number of restraints with -Ln(pdf) > VIOL_REPORT_CUT2[i].
   RMS_1   ... RMS(feature, minimally_violated_basis_restraint, NUMB).
   RMS_2   ... RMS(feature, best_value, NUMB).
   MOL.PDF ... scaled contribution to -Ln(Molecular pdf).

 #                     RESTRAINT_GROUP      NUM   NUMVI  NUMVP   RMS_1   RMS_2         MOL.PDF     S_i
------------------------------------------------------------------------------------------------------
 1 Bond length potential              :    1178       0      0   0.006   0.006      11.963       1.000
 2 Bond angle potential               :    1592       0      7   2.042   2.042      135.67       1.000
 3 Stereochemical cosine torsion poten:     736       0     25  48.046  48.046      266.29       1.000
 4 Stereochemical improper torsion pot:     480       0      0   1.312   1.312      18.881       1.000
 5 Soft-sphere overlap restraints     :    2361       0      0   0.001   0.001     0.56495       1.000
 6 Lennard-Jones 6-12 potential       :       0       0      0   0.000   0.000      0.0000       1.000
 7 Coulomb point-point electrostatic p:       0       0      0   0.000   0.000      0.0000       1.000
 8 H-bonding potential                :       0       0      0   0.000   0.000      0.0000       1.000
 9 Distance restraints 1 (CA-CA)      :    2405       0      0   0.135   0.135      46.168       1.000
10 Distance restraints 2 (N-O)        :    2564       2     10   0.196   0.196      120.58       1.000
11 Mainchain Phi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
12 Mainchain Psi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
13 Mainchain Omega dihedral restraints:     147       0      3   4.361   4.361      32.970       1.000
14 Sidechain Chi_1 dihedral restraints:     120       0      1  67.969  67.969      24.753       1.000
15 Sidechain Chi_2 dihedral restraints:      87       0      1  63.212  63.212      31.786       1.000
16 Sidechain Chi_3 dihedral restraints:      36       0      0  93.940  93.940      22.159       1.000
17 Sidechain Chi_4 dihedral restraints:      20       0      0  98.390  98.390      13.630       1.000
18 Disulfide distance restraints      :       4       0      0   0.011   0.011     0.78846E-01   1.000
19 Disulfide angle restraints         :       8       0      0   1.908   1.908     0.64309       1.000
20 Disulfide dihedral angle restraints:       4       0      0  26.451  26.451      2.7758       1.000
21 Lower bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
22 Upper bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
23 Distance restraints 3 (SDCH-MNCH)  :    1691       0      0   0.421   0.421      38.614       1.000
24 Sidechain Chi_5 dihedral restraints:       0       0      0   0.000   0.000      0.0000       1.000
25 Phi/Psi pair of dihedral restraints:     146      16     16  23.218  59.765      40.285       1.000
26 Distance restraints 4 (SDCH-SDCH)  :     972       0      0   0.680   0.680      62.783       1.000
27 Distance restraints 5 (X-Y)        :       0       0      0   0.000   0.000      0.0000       1.000
28 NMR distance restraints 6 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
29 NMR distance restraints 7 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
30 Minimal distance restraints        :       0       0      0   0.000   0.000      0.0000       1.000
31 Non-bonded restraints              :       0       0      0   0.000   0.000      0.0000       1.000
32 Atomic accessibility restraints    :       0       0      0   0.000   0.000      0.0000       1.000
33 Atomic density restraints          :       0       0      0   0.000   0.000      0.0000       1.000
34 Absolute position restraints       :       0       0      0   0.000   0.000      0.0000       1.000
35 Dihedral angle difference restraint:       0       0      0   0.000   0.000      0.0000       1.000
36 GBSA implicit solvent potential    :       0       0      0   0.000   0.000      0.0000       1.000
37 EM density fitting potential       :       0       0      0   0.000   0.000      0.0000       1.000
38 SAXS restraints                    :       0       0      0   0.000   0.000      0.0000       1.000
39 Symmetry restraints                :       0       0      0   0.000   0.000      0.0000       1.000



# Heavy relative violation of each residue is written to: model.V99990001
# The profile is NOT normalized by the number of restraints.
# The profiles are smoothed over a window of residues:    1
# The sum of all numbers in the file:   14735.9307



List of the violated restraints:
   A restraint is violated when the relative difference
   from the best value (RVIOL) is larger than CUTOFF.

   ICSR   ... index of a restraint in the current set.
   RESNO  ... residue numbers of the first two atoms.
   ATM    ... IUPAC atom names of the first two atoms.
   FEAT   ... the value of the feature in the model.
   restr  ... the mean of the basis restraint with the smallest
              difference from the model (local minimum).
   viol   ... difference from the local minimum.
   rviol  ... relative difference from the local minimum.
   RESTR  ... the best value (global minimum).
   VIOL   ... difference from the best value.
   RVIOL  ... relative difference from the best value.


-------------------------------------------------------------------------------------------------

Feature 10                           : Distance restraints 2 (N-O)             
List of the RVIOL violations larger than   :       4.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   7443  45N  38Y N   O     337  294   11.73    9.41    2.31    4.85    9.41    2.31    4.85
    2   7472  46W  38Y N   O     345  294   11.04    8.62    2.43    5.49    8.62    2.43    5.49

-------------------------------------------------------------------------------------------------

Feature 25                           : Phi/Psi pair of dihedral restraints     
List of the RVIOL violations larger than   :       6.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   4003   1M   2K C   N       7    9  -74.63  -70.20    6.44    0.39  -62.90  174.51   23.32
    1          2K   2K N   CA      9   10  145.08  140.40                  -40.80
    2   4004   2K   3A C   N      16   18 -130.60 -134.00    3.84    0.20  -62.50 -176.58   33.71
    2          3A   3A N   CA     18   19  148.79  147.00                  -40.90
    3   4005   3A   4L C   N      21   23  -88.83 -108.50   32.88    1.52  -63.50  149.52   19.45
    3          4L   4L N   CA     23   24  106.15  132.50                  -41.20
    4   4008   6V   7L C   N      44   46 -143.48 -108.50   68.42    3.25  -63.50  150.51   25.80
    4          7L   7L N   CA     46   47 -168.70  132.50                  -41.20
    5   4010   8G   9L C   N      56   58  -54.95  -70.70   18.11    1.30  -63.50  174.07   24.67
    5          9L   9L N   CA     58   59  132.66  141.60                  -41.20
    6   4012  10V  11L C   N      71   73  -84.98 -108.50   38.19    1.76  -63.50  145.21   19.04
    6         11L  11L N   CA     73   74  102.41  132.50                  -41.20
    7   4013  11L  12L C   N      79   81 -112.71 -108.50    4.75    0.21  -63.50 -177.35   23.05
    7         12L  12L N   CA     81   82  134.70  132.50                  -41.20
    8   4014  12L  13S C   N      87   89 -118.87 -136.60   21.88    0.67  -64.10 -178.18   11.21
    8         13S  13S N   CA     89   90  138.37  151.20                  -35.00
    9   4016  14V  15M C   N     100  102  -72.28  -73.00   24.51    1.67  -63.40  152.26   23.43
    9         15M  15M N   CA    102  103  167.50  143.00                  -40.50
   10   4018  16V  17Q C   N     115  117 -137.36 -121.10   29.49    1.06  -63.80  171.93   29.12
   10         17Q  17Q N   CA    117  118  164.30  139.70                  -40.30
   11   4019  17Q  18G C   N     124  126 -153.76 -167.20   27.96    0.83   82.20 -171.77   14.23
   11         18G  18G N   CA    126  127  150.09  174.60                    8.50
   12   4020  18G  19K C   N     128  130 -137.04 -118.00   19.23    0.78  -62.90 -167.95   22.16
   12         19K  19K N   CA    130  131  136.36  139.10                  -40.80
   13   4039  37G  38Y C   N     281  283  -60.66  -63.50   13.00    1.92  -98.40  179.53   18.55
   13         38Y  38Y N   CA    283  284  -56.08  -43.40                  128.40
   14   4040  38Y  39R C   N     293  295 -121.67 -125.20   86.80    4.12   57.30  179.67   20.18
   14         39R  39R N   CA    295  296   53.87  140.60                   38.00
   15   4055  53E  54S C   N     416  418 -137.75  -64.10   81.01    8.59  -64.10   81.01    8.59
   15         54S  54S N   CA    418  419   -1.25  -35.00                  -35.00
   16   4067  65A  66G C   N     509  511  -66.54  -62.40    4.53    0.86   82.20  157.42   11.98
   16         66G  66G N   CA    511  512  -43.05  -41.20                    8.50


report______> Distribution of short non-bonded contacts:


DISTANCE1:  0.00 2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40
DISTANCE2:  2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40 3.50
FREQUENCY:     0    0    0    0    0    4    8   37   68  116  107  121  166  177  199


<< end of ENERGY.

>> Summary of successfully produced models:
Filename                          molpdf
----------------------------------------
model.B99990001.pdb            870.59076

In [8]:
nv.show_structure_file('model.B99990001.pdb')
In [17]:
Image('./1.png')
Out[17]:
In [9]:
# nv.show_structure_file('model.B99990002.pdb')

Добавляем лиганд:

In [10]:
## Получить список остаков
alignm[0].residues[:]
Out[10]:
[Residue MET,
 Residue LYS,
 Residue ALA,
 Residue LEU,
 Residue ILE,
 Residue VAL,
 Residue LEU,
 Residue GLY,
 Residue LEU,
 Residue VAL,
 Residue LEU,
 Residue LEU,
 Residue SER,
 Residue VAL,
 Residue MET,
 Residue VAL,
 Residue GLN,
 Residue GLY,
 Residue LYS,
 Residue VAL,
 Residue PHE,
 Residue GLU,
 Residue ARG,
 Residue CYS,
 Residue GLU,
 Residue LEU,
 Residue ALA,
 Residue ARG,
 Residue THR,
 Residue LEU,
 Residue LYS,
 Residue ARG,
 Residue LEU,
 Residue GLY,
 Residue MET,
 Residue ASP,
 Residue GLY,
 Residue TYR,
 Residue ARG,
 Residue GLY,
 Residue ILE,
 Residue SER,
 Residue LEU,
 Residue ALA,
 Residue ASN,
 Residue TRP,
 Residue MET,
 Residue CYS,
 Residue LEU,
 Residue ALA,
 Residue LYS,
 Residue TRP,
 Residue GLU,
 Residue SER,
 Residue GLY,
 Residue TYR,
 Residue ASN,
 Residue THR,
 Residue ARG,
 Residue ALA,
 Residue THR,
 Residue ASN,
 Residue TYR,
 Residue ASN,
 Residue ALA,
 Residue GLY,
 Residue ASP,
 Residue ARG,
 Residue SER,
 Residue THR,
 Residue ASP,
 Residue TYR,
 Residue GLY,
 Residue ILE,
 Residue PHE,
 Residue GLN,
 Residue ILE,
 Residue ASN,
 Residue SER,
 Residue ARG,
 Residue TYR,
 Residue TRP,
 Residue CYS,
 Residue ASN,
 Residue ASP,
 Residue GLY,
 Residue LYS,
 Residue THR,
 Residue PRO,
 Residue GLY,
 Residue ALA,
 Residue VAL,
 Residue ASN,
 Residue ALA,
 Residue CYS,
 Residue HIS,
 Residue LEU,
 Residue SER,
 Residue CYS,
 Residue SER,
 Residue ALA,
 Residue LEU,
 Residue LEU,
 Residue GLN,
 Residue ASP,
 Residue ASN,
 Residue ILE,
 Residue ALA,
 Residue ASP,
 Residue ALA,
 Residue VAL,
 Residue ALA,
 Residue CYS,
 Residue ALA,
 Residue LYS,
 Residue ARG,
 Residue VAL,
 Residue VAL,
 Residue ARG,
 Residue ASP,
 Residue PRO,
 Residue GLN,
 Residue GLY,
 Residue ILE,
 Residue ARG,
 Residue ALA,
 Residue TRP,
 Residue VAL,
 Residue ALA,
 Residue TRP,
 Residue ARG,
 Residue ASN,
 Residue ARG,
 Residue CYS,
 Residue GLN,
 Residue ASN,
 Residue ARG,
 Residue ASP,
 Residue VAL,
 Residue ARG,
 Residue GLN,
 Residue TYR,
 Residue VAL,
 Residue GLN,
 Residue GLY,
 Residue CYS,
 Residue GLY,
 Residue VAL]
In [11]:
seq = ''
for i in alignm[0].residues:
    seq += i.code
seq += '...'
alignm.append_sequence(seq)

seq
Out[11]:
'MKALIVLGLVLLSVMVQGKVFERCELARTLKRLGMDGYRGISLANWMCLAKWESGYNTRATNYNAGDRSTDYGIFQINSRYWCNDGKTPGAVNACHLSCSALLQDNIADAVACAKRVVRDPQGIRAWVAWRNRCQNRDVRQYVQGCGV...'
In [12]:
# повторяем
alignm.salign()
alignm.write(file = 'all_in_one_and_ligand.ali', alignment_format = 'PIR')

## Выбираем объект для моделирования 
s = alignm[2]
pdb = alignm[1]

# print s.code, pdb.code

## Создаем объект automodel с лигандом
a = modeller.automodel.automodel(env, alnfile = 'all_in_one_and_ligand.ali', knowns = pdb.code, sequence = s.code)

a.name = 'mod' + s.code
a.starting_model = 1
a.ending_model = 1 #2
a.make()
SALIGN_____> adding the next group to the alignment; iteration    1

SALIGN_____> adding the next group to the alignment; iteration    2
automodel__W> Topology and/or parameter libraries already in memory. These will
                be used instead of the automodel defaults. If this is not what you
                want, clear them before creating the automodel object with
                env.libs.topology.clear() and env.libs.parameters.clear()
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)

check_ali___> Checking the sequence-structure alignment. 

Implied intrachain target CA(i)-CA(i+1) distances longer than  8.0 angstroms:

ALN_POS  TMPL  RID1  RID2  NAM1  NAM2     DIST
----------------------------------------------
END OF TABLE

getf_______W> RTF restraint not found in the atoms list:
              residue type, indices:    18   148
              atom names           : C     +N
              atom indices         :  1156     0

getf_______W> RTF restraint not found in the atoms list:
              residue type, indices:    18   148
              atom names           : C     CA    +N    O
              atom indices         :  1156  1152     0  1157
fndatmi_285W> Only      129 residues out of      132 contain atoms of type  CA
              (This is usually caused by non-standard residues, such
              as ligands, or by PDB files with missing atoms.)
patch_s_522_> Number of disulfides patched in MODEL:        4
mdtrsr__446W> A potential that relies on one protein is used, yet you have at
              least one known structure available. MDT, not library, potential is used.
iup2crm_280W> No topology library in memory or assigning a BLK residue.
              Default CHARMM atom type assigned:  C1 -->  CT2
              This message is written only for the first such atom.
43 atoms in HETATM/BLK residues constrained
to protein atoms within 2.30 angstroms
and protein CA atoms within 10.00 angstroms
43 atoms in residues without defined topology
constrained to be rigid bodies
condens_443_> Restraints marked for deletion were removed.
              Total number of restraints before, now:    14598    13591


>> ENERGY; Differences between the model's features and restraints:
Number of all residues in MODEL                   :      151
Number of all, selected real atoms                :     1201    1201
Number of all, selected pseudo atoms              :        0       0
Number of all static, selected restraints         :    13591   13591
COVALENT_CYS                                      :        F
NONBONDED_SEL_ATOMS                               :        1
Number of non-bonded pairs (excluding 1-2,1-3,1-4):     2545
Dynamic pairs routine                             : 2, NATM x NATM cell sorting
Atomic shift for contacts update (UPDATE_DYNAMIC) :    0.390
LENNARD_JONES_SWITCH                              :    6.500   7.500
COULOMB_JONES_SWITCH                              :    6.500   7.500
RESIDUE_SPAN_RANGE                                :        0   99999
NLOGN_USE                                         :       15
CONTACT_SHELL                                     :    4.000
DYNAMIC_PAIRS,_SPHERE,_COULOMB,_LENNARD,_MODELLER :        T       T       F       F       F
SPHERE_STDV                                       :    0.050
RADII_FACTOR                                      :    0.820
Current energy                                    :         859.5407





Summary of the restraint violations: 

   NUM     ... number of restraints.
   NUMVI   ... number of restraints with RVIOL > VIOL_REPORT_CUT[i].
   RVIOL   ... relative difference from the best value.
   NUMVP   ... number of restraints with -Ln(pdf) > VIOL_REPORT_CUT2[i].
   RMS_1   ... RMS(feature, minimally_violated_basis_restraint, NUMB).
   RMS_2   ... RMS(feature, best_value, NUMB).
   MOL.PDF ... scaled contribution to -Ln(Molecular pdf).

 #                     RESTRAINT_GROUP      NUM   NUMVI  NUMVP   RMS_1   RMS_2         MOL.PDF     S_i
------------------------------------------------------------------------------------------------------
 1 Bond length potential              :    1178       0      0   0.006   0.006      12.800       1.000
 2 Bond angle potential               :    1592       0     10   2.163   2.163      151.76       1.000
 3 Stereochemical cosine torsion poten:     736       0     22  47.422  47.422      262.08       1.000
 4 Stereochemical improper torsion pot:     480       0      0   1.329   1.329      19.397       1.000
 5 Soft-sphere overlap restraints     :    2545       2      2   0.008   0.008      17.429       1.000
 6 Lennard-Jones 6-12 potential       :       0       0      0   0.000   0.000      0.0000       1.000
 7 Coulomb point-point electrostatic p:       0       0      0   0.000   0.000      0.0000       1.000
 8 H-bonding potential                :       0       0      0   0.000   0.000      0.0000       1.000
 9 Distance restraints 1 (CA-CA)      :    2405       0      0   0.121   0.121      37.581       1.000
10 Distance restraints 2 (N-O)        :    2564       0      0   0.149   0.149      63.872       1.000
11 Mainchain Phi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
12 Mainchain Psi dihedral restraints  :       0       0      0   0.000   0.000      0.0000       1.000
13 Mainchain Omega dihedral restraints:     147       0      3   4.812   4.812      40.145       1.000
14 Sidechain Chi_1 dihedral restraints:     120       0      1  68.839  68.839      22.180       1.000
15 Sidechain Chi_2 dihedral restraints:      87       0      0  63.678  63.678      39.337       1.000
16 Sidechain Chi_3 dihedral restraints:      36       0      0  79.723  79.723      24.668       1.000
17 Sidechain Chi_4 dihedral restraints:      20       0      0  98.916  98.916      13.332       1.000
18 Disulfide distance restraints      :       4       0      0   0.008   0.008     0.46799E-01   1.000
19 Disulfide angle restraints         :       8       0      0   2.816   2.816      1.4007       1.000
20 Disulfide dihedral angle restraints:       4       0      0  24.692  24.692      2.4001       1.000
21 Lower bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
22 Upper bound distance restraints    :       0       0      0   0.000   0.000      0.0000       1.000
23 Distance restraints 3 (SDCH-MNCH)  :    1691       0      0   0.432   0.432      45.067       1.000
24 Sidechain Chi_5 dihedral restraints:       0       0      0   0.000   0.000      0.0000       1.000
25 Phi/Psi pair of dihedral restraints:     146      13     16  19.199  56.846      22.750       1.000
26 Distance restraints 4 (SDCH-SDCH)  :     972       0      0   0.696   0.696      69.193       1.000
27 Distance restraints 5 (X-Y)        :    1401       0      0   0.033   0.033      14.103       1.000
28 NMR distance restraints 6 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
29 NMR distance restraints 7 (X-Y)    :       0       0      0   0.000   0.000      0.0000       1.000
30 Minimal distance restraints        :       0       0      0   0.000   0.000      0.0000       1.000
31 Non-bonded restraints              :       0       0      0   0.000   0.000      0.0000       1.000
32 Atomic accessibility restraints    :       0       0      0   0.000   0.000      0.0000       1.000
33 Atomic density restraints          :       0       0      0   0.000   0.000      0.0000       1.000
34 Absolute position restraints       :       0       0      0   0.000   0.000      0.0000       1.000
35 Dihedral angle difference restraint:       0       0      0   0.000   0.000      0.0000       1.000
36 GBSA implicit solvent potential    :       0       0      0   0.000   0.000      0.0000       1.000
37 EM density fitting potential       :       0       0      0   0.000   0.000      0.0000       1.000
38 SAXS restraints                    :       0       0      0   0.000   0.000      0.0000       1.000
39 Symmetry restraints                :       0       0      0   0.000   0.000      0.0000       1.000



# Heavy relative violation of each residue is written to: .V99990001
# The profile is NOT normalized by the number of restraints.
# The profiles are smoothed over a window of residues:    1
# The sum of all numbers in the file:   14851.0059



List of the violated restraints:
   A restraint is violated when the relative difference
   from the best value (RVIOL) is larger than CUTOFF.

   ICSR   ... index of a restraint in the current set.
   RESNO  ... residue numbers of the first two atoms.
   ATM    ... IUPAC atom names of the first two atoms.
   FEAT   ... the value of the feature in the model.
   restr  ... the mean of the basis restraint with the smallest
              difference from the model (local minimum).
   viol   ... difference from the local minimum.
   rviol  ... relative difference from the local minimum.
   RESTR  ... the best value (global minimum).
   VIOL   ... difference from the best value.
   RVIOL  ... relative difference from the best value.


-------------------------------------------------------------------------------------------------

Feature 25                           : Phi/Psi pair of dihedral restraints     
List of the RVIOL violations larger than   :       6.5000

    #   ICSR  RESNO1/2 ATM1/2   INDATM1/2    FEAT   restr    viol   rviol   RESTR    VIOL   RVIOL
    1   4003   1M   2K C   N       7    9  -84.44  -70.20   33.37    2.10  -62.90  150.17   20.74
    1          2K   2K N   CA      9   10  170.58  140.40                  -40.80
    2   4004   2K   3A C   N      16   18  -61.70  -68.20   11.59    1.12  -62.50  164.20   26.87
    2          3A   3A N   CA     18   19  154.90  145.30                  -40.90
    3   4005   3A   4L C   N      21   23  -61.90  -70.70    9.23    0.74  -63.50  179.98   24.90
    3          4L   4L N   CA     23   24  138.82  141.60                  -41.20
    4   4008   6V   7L C   N      44   46  -64.39  -70.70   10.70    1.04  -63.50  168.55   23.45
    4          7L   7L N   CA     46   47  150.25  141.60                  -41.20
    5   4009   7L   8G C   N      52   54  115.88   78.70   37.30    1.81   82.20 -179.29    7.08
    5          8G   8G N   CA     54   55 -169.04 -166.10                    8.50
    6   4010   8G   9L C   N      56   58 -111.66 -108.50    3.19    0.16  -63.50  179.86   22.70
    6          9L   9L N   CA     58   59  132.09  132.50                  -41.20
    7   4012  10V  11L C   N      71   73 -123.67 -108.50   15.18    0.73  -63.50 -176.75   22.80
    7         11L  11L N   CA     73   74  131.89  132.50                  -41.20
    8   4013  11L  12L C   N      79   81  -86.97  -70.70   21.45    1.41  -63.50  164.90   24.31
    8         12L  12L N   CA     81   82  155.58  141.60                  -41.20
    9   4014  12L  13S C   N      87   89  -58.56  -72.40   46.15    2.28  -64.10  143.49   10.73
    9         13S  13S N   CA     89   90  108.38  152.40                  -35.00
   10   4016  14V  15M C   N     100  102  -62.94  -73.00   14.48    0.92  -63.40  173.09   25.88
   10         15M  15M N   CA    102  103  132.59  143.00                  -40.50
   11   4018  16V  17Q C   N     115  117 -120.46 -121.10    3.08    0.16  -63.80 -174.16   30.34
   11         17Q  17Q N   CA    117  118  142.71  139.70                  -40.30
   12   4020  18G  19K C   N     128  130 -119.43 -118.00    6.38    0.32  -62.90 -177.35   21.34
   12         19K  19K N   CA    130  131  132.89  139.10                  -40.80
   13   4067  65A  66G C   N     509  511  -73.73  -62.40   11.38    1.99   82.20  163.35   12.34
   13         66G  66G N   CA    511  512  -40.15  -41.20                    8.50


report______> Distribution of short non-bonded contacts:


DISTANCE1:  0.00 2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40
DISTANCE2:  2.10 2.20 2.30 2.40 2.50 2.60 2.70 2.80 2.90 3.00 3.10 3.20 3.30 3.40 3.50
FREQUENCY:     0    0    0    0    0    8   10   55   85  132  111  146  167  187  217


<< end of ENERGY.

>> Summary of successfully produced models:
Filename                          molpdf
----------------------------------------
.B99990001.pdb                 859.54071

In [13]:
nv.show_structure_file('.B99990001.pdb')
In [18]:
Image('./2.png')
Out[18]:
In [14]:
# nv.show_structure_file('.B99990002.pdb')